Anti GABRG1 pAb (ATL-HPA058102)

Atlas Antibodies

SKU: ATL-HPA058102-25

• 

Protein Description: gamma-aminobutyric acid type A receptor gamma1 subunit
Gene Name: GABRG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001260: 83%, ENSRNOG00000002360: 83%
Entrez Gene ID: 2565
Uniprot ID: Q8N1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
• Gene Sequence: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
• Gene ID - Mouse: ENSMUSG00000001260
• Gene ID - Rat: ENSRNOG00000002360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.