Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004052-25

• 
• 
• 

Protein Description: GTPase activating protein (SH3 domain) binding protein 1
Gene Name: G3BP1
Alternative Gene Name: G3BP, HDH-VIII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018583: 88%, ENSRNOG00000013186: 87%
Entrez Gene ID: 10146
Uniprot ID: Q13283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
• Gene Sequence: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
• Gene ID - Mouse: ENSMUSG00000018583
• Gene ID - Rat: ENSRNOG00000013186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti G3BP1 pAb (ATL-HPA004052 w/enhanced validation) – 1 Found

Deng, Zhiqiang; Lim, Junghyun; Wang, Qian; Purtell, Kerry; Wu, Shuai; Palomo, Gloria M; Tan, Haiyan; Manfredi, Giovanni; Zhao, Yanxiang; Peng, Junmin; Hu, Bo; Chen, Shi; Yue, Zhenyu. ALS-FTLD-linked mutations of SQSTM1/p62 disrupt selective autophagy and NFE2L2/NRF2 anti-oxidative stress pathway. Autophagy. 2020;16(5):917-931.