Anti FZD5 pAb (ATL-HPA052361)

Atlas Antibodies

SKU: ATL-HPA052361-25

• 

Protein Description: frizzled class receptor 5
Gene Name: FZD5
Alternative Gene Name: C2orf31, DKFZP434E2135, HFZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045005: 91%, ENSRNOG00000014678: 91%
Entrez Gene ID: 7855
Uniprot ID: Q13467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
• Gene Sequence: WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
• Gene ID - Mouse: ENSMUSG00000045005
• Gene ID - Rat: ENSRNOG00000014678
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.