Anti FUT3 pAb (ATL-HPA046966)

Atlas Antibodies

SKU: ATL-HPA046966-25

• 

Protein Description: fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
Gene Name: FUT3
Alternative Gene Name: CD174, LE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055373: 39%, ENSRNOG00000008475: 39%
Entrez Gene ID: 2525
Uniprot ID: P21217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
• Gene Sequence: KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
• Gene ID - Mouse: ENSMUSG00000055373
• Gene ID - Rat: ENSRNOG00000008475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.