Anti FUT10 pAb (ATL-HPA058655)

Atlas Antibodies

SKU:
ATL-HPA058655-25
  • Immunohistochemical staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
Gene Name: FUT10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046152: 69%, ENSRNOG00000050857: 73%
Entrez Gene ID: 84750
Uniprot ID: Q6P4F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPP
Gene Sequence TALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPP
Gene ID - Mouse ENSMUSG00000046152
Gene ID - Rat ENSRNOG00000050857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FUT10 pAb (ATL-HPA058655)
Datasheet Anti FUT10 pAb (ATL-HPA058655) Datasheet (External Link)
Vendor Page Anti FUT10 pAb (ATL-HPA058655) at Atlas Antibodies

Documents & Links for Anti FUT10 pAb (ATL-HPA058655)
Datasheet Anti FUT10 pAb (ATL-HPA058655) Datasheet (External Link)
Vendor Page Anti FUT10 pAb (ATL-HPA058655)