Anti FUT10 pAb (ATL-HPA053970)

Atlas Antibodies

SKU: ATL-HPA053970-100

• 
• 

Protein Description: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
Gene Name: FUT10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046152: 65%, ENSRNOG00000050857: 66%
Entrez Gene ID: 84750
Uniprot ID: Q6P4F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHH
• Gene Sequence: LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHH
• Gene ID - Mouse: ENSMUSG00000046152
• Gene ID - Rat: ENSRNOG00000050857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FUT10 pAb (ATL-HPA053970) – 1 Found

Mulari, Severi; Eskin, Arda; Lampinen, Milla; Nummi, Annu; Nieminen, Tuomo; Teittinen, Kari; Ojala, Teija; Kankainen, Matti; Vento, Antti; Laurikka, Jari; Kupari, Markku; Harjula, Ari; Tuncbag, Nurcan; Kankuri, Esko. Ischemic Heart Disease Selectively Modifies the Right Atrial Appendage Transcriptome. Frontiers In Cardiovascular Medicine. 8( 34926599):728198.