Anti FUBP3 pAb (ATL-HPA058392)

Atlas Antibodies

SKU: ATL-HPA058392-100

• 
• 

Protein Description: far upstream element (FUSE) binding protein 3
Gene Name: FUBP3
Alternative Gene Name: FBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026843: 100%, ENSRNOG00000009139: 96%
Entrez Gene ID: 8939
Uniprot ID: Q96I24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
• Gene Sequence: MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
• Gene ID - Mouse: ENSMUSG00000026843
• Gene ID - Rat: ENSRNOG00000009139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.