Anti FTSJ3 pAb (ATL-HPA055544)

Atlas Antibodies

SKU:
ATL-HPA055544-25
  • Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FtsJ homolog 3 (E. coli)
Gene Name: FTSJ3
Alternative Gene Name: SPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020706: 97%, ENSRNOG00000009857: 95%
Entrez Gene ID: 117246
Uniprot ID: Q8IY81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVLGRKELRSL
Gene Sequence FVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVLGRKELRSL
Gene ID - Mouse ENSMUSG00000020706
Gene ID - Rat ENSRNOG00000009857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FTSJ3 pAb (ATL-HPA055544)
Datasheet Anti FTSJ3 pAb (ATL-HPA055544) Datasheet (External Link)
Vendor Page Anti FTSJ3 pAb (ATL-HPA055544) at Atlas Antibodies

Documents & Links for Anti FTSJ3 pAb (ATL-HPA055544)
Datasheet Anti FTSJ3 pAb (ATL-HPA055544) Datasheet (External Link)
Vendor Page Anti FTSJ3 pAb (ATL-HPA055544)