Protein Description: FTO, alpha-ketoglutarate dependent dioxygenase
Gene Name: FTO
Alternative Gene Name: ALKBH9, KIAA1752, MGC5149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055932: 88%, ENSRNOG00000011728: 89%
Entrez Gene ID: 79068
Uniprot ID: Q9C0B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FTO
Alternative Gene Name: ALKBH9, KIAA1752, MGC5149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055932: 88%, ENSRNOG00000011728: 89%
Entrez Gene ID: 79068
Uniprot ID: Q9C0B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA |
| Documents & Links for Anti FTO pAb (ATL-HPA068695 w/enhanced validation) | |
| Datasheet | Anti FTO pAb (ATL-HPA068695 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FTO pAb (ATL-HPA068695 w/enhanced validation) at Atlas |
| Documents & Links for Anti FTO pAb (ATL-HPA068695 w/enhanced validation) | |
| Datasheet | Anti FTO pAb (ATL-HPA068695 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FTO pAb (ATL-HPA068695 w/enhanced validation) |
| Citations for Anti FTO pAb (ATL-HPA068695 w/enhanced validation) – 1 Found |
| Zou, Dongling; Dong, Lei; Li, Chenying; Yin, Zhe; Rao, Shuan; Zhou, Qi. The m(6)A eraser FTO facilitates proliferation and migration of human cervical cancer cells. Cancer Cell International. 19( 31827395):321. PubMed |