Anti FSTL3 pAb (ATL-HPA045378)

Atlas Antibodies

SKU:
ATL-HPA045378-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: follistatin-like 3 (secreted glycoprotein)
Gene Name: FSTL3
Alternative Gene Name: FLRG, FSRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020325: 84%, ENSRNOG00000009311: 85%
Entrez Gene ID: 10272
Uniprot ID: O95633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
Gene Sequence MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
Gene ID - Mouse ENSMUSG00000020325
Gene ID - Rat ENSRNOG00000009311
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FSTL3 pAb (ATL-HPA045378)
Datasheet Anti FSTL3 pAb (ATL-HPA045378) Datasheet (External Link)
Vendor Page Anti FSTL3 pAb (ATL-HPA045378) at Atlas Antibodies

Documents & Links for Anti FSTL3 pAb (ATL-HPA045378)
Datasheet Anti FSTL3 pAb (ATL-HPA045378) Datasheet (External Link)
Vendor Page Anti FSTL3 pAb (ATL-HPA045378)