Protein Description: follicle stimulating hormone, beta polypeptide
Gene Name: FSHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027120: 87%, ENSRNOG00000004898: 85%
Entrez Gene ID: 2488
Uniprot ID: P01225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FSHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027120: 87%, ENSRNOG00000004898: 85%
Entrez Gene ID: 2488
Uniprot ID: P01225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK |
| Documents & Links for Anti FSHB pAb (ATL-HPA069703) | |
| Datasheet | Anti FSHB pAb (ATL-HPA069703) Datasheet (External Link) |
| Vendor Page | Anti FSHB pAb (ATL-HPA069703) at Atlas |
| Documents & Links for Anti FSHB pAb (ATL-HPA069703) | |
| Datasheet | Anti FSHB pAb (ATL-HPA069703) Datasheet (External Link) |
| Vendor Page | Anti FSHB pAb (ATL-HPA069703) |