Protein Description: fyn related Src family tyrosine kinase
Gene Name: FRK
Alternative Gene Name: GTK, PTK5, RAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019779: 85%, ENSRNOG00000000543: 87%
Entrez Gene ID: 2444
Uniprot ID: P42685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FRK
Alternative Gene Name: GTK, PTK5, RAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019779: 85%, ENSRNOG00000000543: 87%
Entrez Gene ID: 2444
Uniprot ID: P42685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ |
| Documents & Links for Anti FRK pAb (ATL-HPA072590) | |
| Datasheet | Anti FRK pAb (ATL-HPA072590) Datasheet (External Link) |
| Vendor Page | Anti FRK pAb (ATL-HPA072590) at Atlas |
| Documents & Links for Anti FRK pAb (ATL-HPA072590) | |
| Datasheet | Anti FRK pAb (ATL-HPA072590) Datasheet (External Link) |
| Vendor Page | Anti FRK pAb (ATL-HPA072590) |