Anti FPR1 pAb (ATL-HPA046550)

Atlas Antibodies

SKU:
ATL-HPA046550-25
  • Immunohistochemical staining of human tonsil shows weak cytoplasmic positivity in non-germinal center cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: formyl peptide receptor 1
Gene Name: FPR1
Alternative Gene Name: FMLP, FPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045551: 61%, ENSRNOG00000011174: 49%
Entrez Gene ID: 2357
Uniprot ID: P21462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT
Gene Sequence TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT
Gene ID - Mouse ENSMUSG00000045551
Gene ID - Rat ENSRNOG00000011174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FPR1 pAb (ATL-HPA046550)
Datasheet Anti FPR1 pAb (ATL-HPA046550) Datasheet (External Link)
Vendor Page Anti FPR1 pAb (ATL-HPA046550) at Atlas Antibodies

Documents & Links for Anti FPR1 pAb (ATL-HPA046550)
Datasheet Anti FPR1 pAb (ATL-HPA046550) Datasheet (External Link)
Vendor Page Anti FPR1 pAb (ATL-HPA046550)