Anti FPGS pAb (ATL-HPA050488)

Atlas Antibodies

Catalog No.:
ATL-HPA050488-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: folylpolyglutamate synthase
Gene Name: FPGS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009566: 80%, ENSRNOG00000050780: 74%
Entrez Gene ID: 2356
Uniprot ID: Q05932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLL
Gene Sequence RVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLL
Gene ID - Mouse ENSMUSG00000009566
Gene ID - Rat ENSRNOG00000050780
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FPGS pAb (ATL-HPA050488)
Datasheet Anti FPGS pAb (ATL-HPA050488) Datasheet (External Link)
Vendor Page Anti FPGS pAb (ATL-HPA050488) at Atlas Antibodies

Documents & Links for Anti FPGS pAb (ATL-HPA050488)
Datasheet Anti FPGS pAb (ATL-HPA050488) Datasheet (External Link)
Vendor Page Anti FPGS pAb (ATL-HPA050488)