Anti FOXRED1 pAb (ATL-HPA046192)

Atlas Antibodies

SKU: ATL-HPA046192-25

• 
• 

Protein Description: FAD-dependent oxidoreductase domain containing 1
Gene Name: FOXRED1
Alternative Gene Name: H17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039048: 79%, ENSRNOG00000060379: 80%
Entrez Gene ID: 55572
Uniprot ID: Q96CU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
• Gene Sequence: LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
• Gene ID - Mouse: ENSMUSG00000039048
• Gene ID - Rat: ENSRNOG00000060379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOXRED1 pAb (ATL-HPA046192) – 1 Found

Fei, Weiqiang; Liu, Shuiping; Hu, Xiaotong. High FOXRED1 expression predicted good prognosis of colorectal cancer. American Journal Of Cancer Research. 6(11):2722-2728.