Anti FOXR2 pAb (ATL-HPA057358)

Atlas Antibodies

SKU: ATL-HPA057358-25

• 
• 
• 

Protein Description: forkhead box R2
Gene Name: FOXR2
Alternative Gene Name: FOXN6, MGC21658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071665: 68%, ENSRNOG00000030619: 68%
Entrez Gene ID: 139628
Uniprot ID: Q6PJQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWM
• Gene Sequence: CEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWM
• Gene ID - Mouse: ENSMUSG00000071665
• Gene ID - Rat: ENSRNOG00000030619
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOXR2 pAb (ATL-HPA057358) – 1 Found

Schmitt-Hoffner, Felix; van Rijn, Sjoerd; Toprak, Umut H; Mauermann, Monika; Rosemann, Felix; Heit-Mondrzyk, Anke; Hübner, Jens-Martin; Camgöz, Aylin; Hartlieb, Sabine; Pfister, Stefan M; Henrich, Kai-Oliver; Westermann, Frank; Kool, Marcel. FOXR2 Stabilizes MYCN Protein and Identifies Non-MYCN-Amplified Neuroblastoma Patients With Unfavorable Outcome. Journal Of Clinical Oncology : Official Journal Of The American Society Of Clinical Oncology. 2021;39(29):3217-3228.