Anti FOXL2 pAb (ATL-HPA069613 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069613-25

• 
• 

Protein Description: forkhead box L2
Gene Name: FOXL2
Alternative Gene Name: BPES, BPES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050397: 82%, ENSRNOG00000017190: 79%
Entrez Gene ID: 668
Uniprot ID: P58012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG
• Gene Sequence: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG
• Gene ID - Mouse: ENSMUSG00000050397
• Gene ID - Rat: ENSRNOG00000017190
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.