Anti FOXC2 pAb (ATL-HPA056302)
Atlas Antibodies
- SKU:
- ATL-HPA056302-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FOXC2
Alternative Gene Name: FKHL14, MFH-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046714: 88%, ENSRNOG00000047446: 89%
Entrez Gene ID: 2303
Uniprot ID: Q99958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK |
Gene Sequence | SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK |
Gene ID - Mouse | ENSMUSG00000046714 |
Gene ID - Rat | ENSRNOG00000047446 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOXC2 pAb (ATL-HPA056302) | |
Datasheet | Anti FOXC2 pAb (ATL-HPA056302) Datasheet (External Link) |
Vendor Page | Anti FOXC2 pAb (ATL-HPA056302) at Atlas Antibodies |
Documents & Links for Anti FOXC2 pAb (ATL-HPA056302) | |
Datasheet | Anti FOXC2 pAb (ATL-HPA056302) Datasheet (External Link) |
Vendor Page | Anti FOXC2 pAb (ATL-HPA056302) |