Anti FOSL2 pAb (ATL-HPA061417)

Atlas Antibodies

SKU:
ATL-HPA061417-25
  • Immunohistochemical staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FOS-like antigen 2
Gene Name: FOSL2
Alternative Gene Name: FLJ23306, FRA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029135: 100%, ENSRNOG00000020552: 41%
Entrez Gene ID: 2355
Uniprot ID: P15408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
Gene Sequence WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
Gene ID - Mouse ENSMUSG00000029135
Gene ID - Rat ENSRNOG00000020552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FOSL2 pAb (ATL-HPA061417)
Datasheet Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link)
Vendor Page Anti FOSL2 pAb (ATL-HPA061417) at Atlas Antibodies

Documents & Links for Anti FOSL2 pAb (ATL-HPA061417)
Datasheet Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link)
Vendor Page Anti FOSL2 pAb (ATL-HPA061417)