Anti FOSL2 pAb (ATL-HPA061417)
Atlas Antibodies
- SKU:
- ATL-HPA061417-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FOSL2
Alternative Gene Name: FLJ23306, FRA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029135: 100%, ENSRNOG00000020552: 41%
Entrez Gene ID: 2355
Uniprot ID: P15408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS |
Gene Sequence | WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS |
Gene ID - Mouse | ENSMUSG00000029135 |
Gene ID - Rat | ENSRNOG00000020552 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOSL2 pAb (ATL-HPA061417) | |
Datasheet | Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link) |
Vendor Page | Anti FOSL2 pAb (ATL-HPA061417) at Atlas Antibodies |
Documents & Links for Anti FOSL2 pAb (ATL-HPA061417) | |
Datasheet | Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link) |
Vendor Page | Anti FOSL2 pAb (ATL-HPA061417) |