Anti FOSB pAb (ATL-HPA054663)

Atlas Antibodies

SKU: ATL-HPA054663-25

• 

Protein Description: FBJ murine osteosarcoma viral oncogene homolog B
Gene Name: FOSB
Alternative Gene Name: AP-1, DKFZp686C0818, G0S3, GOS3, GOSB, MGC42291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003545: 94%, ENSRNOG00000046667: 94%
Entrez Gene ID: 2354
Uniprot ID: P53539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
• Gene Sequence: LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
• Gene ID - Mouse: ENSMUSG00000003545
• Gene ID - Rat: ENSRNOG00000046667
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.