Anti FOCAD pAb (ATL-HPA055015)
Atlas Antibodies
- SKU:
- ATL-HPA055015-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FOCAD
Alternative Gene Name: FLJ20375, KIAA1797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038368: 80%, ENSRNOG00000024402: 80%
Entrez Gene ID: 54914
Uniprot ID: Q5VW36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELCPSALHGLSQAMKLPSPAHHLWSLLSEA |
| Gene Sequence | NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELCPSALHGLSQAMKLPSPAHHLWSLLSEA |
| Gene ID - Mouse | ENSMUSG00000038368 |
| Gene ID - Rat | ENSRNOG00000024402 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOCAD pAb (ATL-HPA055015) | |
| Datasheet | Anti FOCAD pAb (ATL-HPA055015) Datasheet (External Link) |
| Vendor Page | Anti FOCAD pAb (ATL-HPA055015) at Atlas Antibodies |
| Documents & Links for Anti FOCAD pAb (ATL-HPA055015) | |
| Datasheet | Anti FOCAD pAb (ATL-HPA055015) Datasheet (External Link) |
| Vendor Page | Anti FOCAD pAb (ATL-HPA055015) |
| Citations for Anti FOCAD pAb (ATL-HPA055015) – 1 Found |
| Liu, Dongjing; Ban, Hyo-Jeong; El Sergani, Ahmed M; Lee, Myoung Keun; Hecht, Jacqueline T; Wehby, George L; Moreno, Lina M; Feingold, Eleanor; Marazita, Mary L; Cha, Seongwon; Szabo-Rogers, Heather L; Weinberg, Seth M; Shaffer, John R. PRICKLE1 × FOCAD Interaction Revealed by Genome-Wide vQTL Analysis of Human Facial Traits. Frontiers In Genetics. 12( 34434215):674642. PubMed |