Anti FNDC5 pAb (ATL-HPA051290)

Atlas Antibodies

SKU: ATL-HPA051290-25

• 

Protein Description: fibronectin type III domain containing 5
Gene Name: FNDC5
Alternative Gene Name: FRCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001334: 100%, ENSRNOG00000030238: 100%
Entrez Gene ID: 252995
Uniprot ID: Q8NAU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
• Gene Sequence: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
• Gene ID - Mouse: ENSMUSG00000001334
• Gene ID - Rat: ENSRNOG00000030238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FNDC5 pAb (ATL-HPA051290) – 1 Found

Komolka, Katrin; Albrecht, Elke; Schering, Lisa; Brenmoehl, Julia; Hoeflich, Andreas; Maak, Steffen. Locus characterization and gene expression of bovine FNDC5: is the myokine irisin relevant in cattle?. Plos One. 9(1):e88060.