Protein Description: formin binding protein 1-like
Gene Name: FNBP1L
Alternative Gene Name: C1orf39, FLJ20275, TOCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039735: 100%, ENSRNOG00000013798: 100%
Entrez Gene ID: 54874
Uniprot ID: Q5T0N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FNBP1L
Alternative Gene Name: C1orf39, FLJ20275, TOCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039735: 100%, ENSRNOG00000013798: 100%
Entrez Gene ID: 54874
Uniprot ID: Q5T0N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII |
| Documents & Links for Anti FNBP1L pAb (ATL-HPA065273) | |
| Datasheet | Anti FNBP1L pAb (ATL-HPA065273) Datasheet (External Link) |
| Vendor Page | Anti FNBP1L pAb (ATL-HPA065273) at Atlas |
| Documents & Links for Anti FNBP1L pAb (ATL-HPA065273) | |
| Datasheet | Anti FNBP1L pAb (ATL-HPA065273) Datasheet (External Link) |
| Vendor Page | Anti FNBP1L pAb (ATL-HPA065273) |