Anti FNBP1L pAb (ATL-HPA065273)

Atlas Antibodies

SKU: ATL-HPA065273-25

• 
• 

Product Description

Protein Description: formin binding protein 1-like
Gene Name: FNBP1L
Alternative Gene Name: C1orf39, FLJ20275, TOCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039735: 100%, ENSRNOG00000013798: 100%
Entrez Gene ID: 54874
Uniprot ID: Q5T0N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII
• Gene Sequence: QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII
• Gene ID - Mouse: ENSMUSG00000039735
• Gene ID - Rat: ENSRNOG00000013798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links