Anti FN3K pAb (ATL-HPA061358 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA061358-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: fructosamine 3 kinase
Gene Name: FN3K
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025175: 92%, ENSRNOG00000036660: 60%
Entrez Gene ID: 64122
Uniprot ID: Q9H479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FN3K
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025175: 92%, ENSRNOG00000036660: 60%
Entrez Gene ID: 64122
Uniprot ID: Q9H479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM |
Gene Sequence | EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM |
Gene ID - Mouse | ENSMUSG00000025175 |
Gene ID - Rat | ENSRNOG00000036660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) | |
Datasheet | Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) | |
Datasheet | Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FN3K pAb (ATL-HPA061358 w/enhanced validation) |