Anti FN3K pAb (ATL-HPA061358 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061358-25

• 

Product Description

Protein Description: fructosamine 3 kinase
Gene Name: FN3K
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025175: 92%, ENSRNOG00000036660: 60%
Entrez Gene ID: 64122
Uniprot ID: Q9H479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM
• Gene Sequence: EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM
• Gene ID - Mouse: ENSMUSG00000025175
• Gene ID - Rat: ENSRNOG00000036660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links