Protein Description: fragile X mental retardation 1
Gene Name: FMR1
Alternative Gene Name: FMRP, FRAXA, MGC87458, POF, POF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000838: 89%, ENSRNOG00000057464: 84%
Entrez Gene ID: 2332
Uniprot ID: Q06787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FMR1
Alternative Gene Name: FMRP, FRAXA, MGC87458, POF, POF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000838: 89%, ENSRNOG00000057464: 84%
Entrez Gene ID: 2332
Uniprot ID: Q06787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFSQPNSTKV |
Documents & Links for Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) | |
Datasheet | Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) at Atlas |
Documents & Links for Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) | |
Datasheet | Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation) |