Anti FMR1 pAb (ATL-HPA056084 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056084-25

• 

Protein Description: fragile X mental retardation 1
Gene Name: FMR1
Alternative Gene Name: FMRP, FRAXA, MGC87458, POF, POF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000838: 89%, ENSRNOG00000057464: 84%
Entrez Gene ID: 2332
Uniprot ID: Q06787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFSQPNSTKV
• Gene Sequence: RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFSQPNSTKV
• Gene ID - Mouse: ENSMUSG00000000838
• Gene ID - Rat: ENSRNOG00000057464
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.