Anti FMO4 pAb (ATL-HPA049100)

Atlas Antibodies

SKU:
ATL-HPA049100-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: flavin containing monooxygenase 4
Gene Name: FMO4
Alternative Gene Name: FMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026692: 78%, ENSRNOG00000003400: 77%
Entrez Gene ID: 2329
Uniprot ID: P31512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEV
Gene Sequence KGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEV
Gene ID - Mouse ENSMUSG00000026692
Gene ID - Rat ENSRNOG00000003400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FMO4 pAb (ATL-HPA049100)
Datasheet Anti FMO4 pAb (ATL-HPA049100) Datasheet (External Link)
Vendor Page Anti FMO4 pAb (ATL-HPA049100) at Atlas Antibodies

Documents & Links for Anti FMO4 pAb (ATL-HPA049100)
Datasheet Anti FMO4 pAb (ATL-HPA049100) Datasheet (External Link)
Vendor Page Anti FMO4 pAb (ATL-HPA049100)