Anti FMN1 pAb (ATL-HPA046786)

Atlas Antibodies

SKU: ATL-HPA046786-25

• 
• 

Protein Description: formin 1
Gene Name: FMN1
Alternative Gene Name: DKFZP686C2281, FLJ45135, FMN, LD, MGC125288, MGC125289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044042: 90%, ENSRNOG00000031760: 92%
Entrez Gene ID: 342184
Uniprot ID: Q68DA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: PLPEPQDFFLASQVKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQ
• Gene ID - Mouse: ENSMUSG00000044042
• Gene ID - Rat: ENSMUSG00000044042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.