Anti FMC1 pAb (ATL-HPA050553)

Atlas Antibodies

SKU: ATL-HPA050553-25

• 
• 

Protein Description: formation of mitochondrial complex V assembly factor 1 homolog
Gene Name: FMC1
Alternative Gene Name: C7orf55, HSPC268
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019689: 93%, ENSRNOG00000005618: 96%
Entrez Gene ID: 154791
Uniprot ID: Q96HJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP
• Gene Sequence: ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP
• Gene ID - Mouse: ENSMUSG00000019689
• Gene ID - Rat: ENSRNOG00000005618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.