Anti FLRT1 pAb (ATL-HPA054589)

Atlas Antibodies

SKU: ATL-HPA054589-25

• 

Protein Description: fibronectin leucine rich transmembrane protein 1
Gene Name: FLRT1
Alternative Gene Name: MGC21624, SPG68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047787: 92%, ENSRNOG00000022428: 92%
Entrez Gene ID: 23769
Uniprot ID: Q9NZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
• Gene Sequence: MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
• Gene ID - Mouse: ENSMUSG00000047787
• Gene ID - Rat: ENSRNOG00000022428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.