Anti FLNA pAb (ATL-HPA000368)

Atlas Antibodies

SKU:
ATL-HPA000368-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: filamin A, alpha
Gene Name: FLNA
Alternative Gene Name: ABP-280, FLN, FLN1, OPD1, OPD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031328: 92%, ENSRNOG00000054890: 91%
Entrez Gene ID: 2316
Uniprot ID: P21333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGS
Gene Sequence FQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGS
Gene ID - Mouse ENSMUSG00000031328
Gene ID - Rat ENSRNOG00000054890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLNA pAb (ATL-HPA000368)
Datasheet Anti FLNA pAb (ATL-HPA000368) Datasheet (External Link)
Vendor Page Anti FLNA pAb (ATL-HPA000368) at Atlas Antibodies

Documents & Links for Anti FLNA pAb (ATL-HPA000368)
Datasheet Anti FLNA pAb (ATL-HPA000368) Datasheet (External Link)
Vendor Page Anti FLNA pAb (ATL-HPA000368)



Citations for Anti FLNA pAb (ATL-HPA000368) – 1 Found
Lindström, Sara; Eriksson, Malin; Vazin, Tandis; Sandberg, Julia; Lundeberg, Joakim; Frisén, Jonas; Andersson-Svahn, Helene. High-density microwell chip for culture and analysis of stem cells. Plos One. 2009;4(9):e6997.  PubMed