Anti FKBP8 pAb (ATL-HPA045177)

Atlas Antibodies

SKU: ATL-HPA045177-100

• 
• 
• 

Protein Description: FK506 binding protein 8, 38kDa
Gene Name: FKBP8
Alternative Gene Name: FKBP38, FKBPr38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019428: 95%, ENSRNOG00000058359: 96%
Entrez Gene ID: 23770
Uniprot ID: Q14318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
• Gene ID - Mouse: ENSMUSG00000019428
• Gene ID - Rat: ENSMUSG00000019428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.