Anti FKBP1A pAb (ATL-HPA051798)

Atlas Antibodies

Catalog No.: ATL-HPA051798-100

Protein Description: FK506 binding protein 1A, 12kDa
Gene Name: FKBP1A
Alternative Gene Name: FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PPIASE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032966: 100%, ENSRNOG00000008822: 97%
Entrez Gene ID: 2280
Uniprot ID: P62942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
• Gene Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
• Gene ID - Mouse: ENSMUSG00000032966
• Gene ID - Rat: ENSRNOG00000008822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.