Anti FKBP10 pAb (ATL-HPA051171)

Atlas Antibodies

SKU: ATL-HPA051171-25

• 
• 

Protein Description: FK506 binding protein 10, 65 kDa
Gene Name: FKBP10
Alternative Gene Name: FKBP6, FLJ20683, FLJ22041, FLJ23833, hFKBP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001555: 93%, ENSRNOG00000015941: 91%
Entrez Gene ID: 60681
Uniprot ID: Q96AY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED
• Gene Sequence: CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED
• Gene ID - Mouse: ENSMUSG00000001555
• Gene ID - Rat: ENSRNOG00000015941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.