Anti FHL3 pAb (ATL-HPA045723 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045723-100

• 
• 

Protein Description: four and a half LIM domains 3
Gene Name: FHL3
Alternative Gene Name: SLIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032643: 100%, ENSRNOG00000007541: 100%
Entrez Gene ID: 2275
Uniprot ID: Q13643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPF
• Gene Sequence: CNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPF
• Gene ID - Mouse: ENSMUSG00000032643
• Gene ID - Rat: ENSRNOG00000007541
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.