![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101336/181426/atl-hpa074638_anti-fgg-pab-atl-hpa074638_63094__32618.1681137751.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: fibrinogen gamma chain
Gene Name: FGG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033860: 77%, ENSRNOG00000025074: 77%
Entrez Gene ID: 2266
Uniprot ID: P02679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033860: 77%, ENSRNOG00000025074: 77%
Entrez Gene ID: 2266
Uniprot ID: P02679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEYDSLYP |
| Documents & Links for Anti FGG pAb (ATL-HPA074638) | |
| Datasheet | Anti FGG pAb (ATL-HPA074638) Datasheet (External Link) |
| Vendor Page | Anti FGG pAb (ATL-HPA074638) at Atlas |
| Documents & Links for Anti FGG pAb (ATL-HPA074638) | |
| Datasheet | Anti FGG pAb (ATL-HPA074638) Datasheet (External Link) |
| Vendor Page | Anti FGG pAb (ATL-HPA074638) |