Anti FGFBP3 pAb (ATL-HPA053943)

Atlas Antibodies

SKU: ATL-HPA053943-25

• 

Protein Description: fibroblast growth factor binding protein 3
Gene Name: FGFBP3
Alternative Gene Name: C10orf13, MGC39320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047632: 59%, ENSRNOG00000022796: 63%
Entrez Gene ID: 143282
Uniprot ID: Q8TAT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
• Gene Sequence: AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
• Gene ID - Mouse: ENSMUSG00000047632
• Gene ID - Rat: ENSRNOG00000022796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.