Anti FGF2 pAb (ATL-HPA065502)

Catalog No:
ATL-HPA065502-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: fibroblast growth factor 2
Gene Name: FGF2
Alternative Gene Name: FGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037225: 97%, ENSRNOG00000017392: 97%
Entrez Gene ID: 2247
Uniprot ID: P09038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL
Gene ID - Mouse ENSMUSG00000037225
Gene ID - Rat ENSMUSG00000037225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti FGF2 pAb (ATL-HPA065502)
Datasheet Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link)
Vendor Page Anti FGF2 pAb (ATL-HPA065502) at Atlas

Documents & Links for Anti FGF2 pAb (ATL-HPA065502)
Datasheet Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link)
Vendor Page Anti FGF2 pAb (ATL-HPA065502)