Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA075188-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: fibroblast growth factor 11
Gene Name: FGF11
Alternative Gene Name: FHF3, FLJ16061, MGC102953, MGC45269
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042826: 100%, ENSRNOG00000014882: 100%
Entrez Gene ID: 2256
Uniprot ID: Q92914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGF11
Alternative Gene Name: FHF3, FLJ16061, MGC102953, MGC45269
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042826: 100%, ENSRNOG00000014882: 100%
Entrez Gene ID: 2256
Uniprot ID: Q92914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN |
Gene Sequence | VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN |
Gene ID - Mouse | ENSMUSG00000042826 |
Gene ID - Rat | ENSRNOG00000014882 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) | |
Datasheet | Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) | |
Datasheet | Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation) |