Anti FGF11 pAb (ATL-HPA075188 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA075188-25

• 

Product Description

Protein Description: fibroblast growth factor 11
Gene Name: FGF11
Alternative Gene Name: FHF3, FLJ16061, MGC102953, MGC45269
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042826: 100%, ENSRNOG00000014882: 100%
Entrez Gene ID: 2256
Uniprot ID: Q92914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
• Gene Sequence: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
• Gene ID - Mouse: ENSMUSG00000042826
• Gene ID - Rat: ENSRNOG00000014882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links