Anti FGD2 pAb (ATL-HPA049692)

Atlas Antibodies

SKU:
ATL-HPA049692-25
  • Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FYVE, RhoGEF and PH domain containing 2
Gene Name: FGD2
Alternative Gene Name: ZFYVE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024013: 74%, ENSRNOG00000000528: 76%
Entrez Gene ID: 221472
Uniprot ID: Q7Z6J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS
Gene Sequence RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS
Gene ID - Mouse ENSMUSG00000024013
Gene ID - Rat ENSRNOG00000000528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FGD2 pAb (ATL-HPA049692)
Datasheet Anti FGD2 pAb (ATL-HPA049692) Datasheet (External Link)
Vendor Page Anti FGD2 pAb (ATL-HPA049692) at Atlas Antibodies

Documents & Links for Anti FGD2 pAb (ATL-HPA049692)
Datasheet Anti FGD2 pAb (ATL-HPA049692) Datasheet (External Link)
Vendor Page Anti FGD2 pAb (ATL-HPA049692)