Anti FGD2 pAb (ATL-HPA049692)
Atlas Antibodies
- SKU:
- ATL-HPA049692-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FGD2
Alternative Gene Name: ZFYVE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024013: 74%, ENSRNOG00000000528: 76%
Entrez Gene ID: 221472
Uniprot ID: Q7Z6J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS |
Gene Sequence | RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS |
Gene ID - Mouse | ENSMUSG00000024013 |
Gene ID - Rat | ENSRNOG00000000528 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FGD2 pAb (ATL-HPA049692) | |
Datasheet | Anti FGD2 pAb (ATL-HPA049692) Datasheet (External Link) |
Vendor Page | Anti FGD2 pAb (ATL-HPA049692) at Atlas Antibodies |
Documents & Links for Anti FGD2 pAb (ATL-HPA049692) | |
Datasheet | Anti FGD2 pAb (ATL-HPA049692) Datasheet (External Link) |
Vendor Page | Anti FGD2 pAb (ATL-HPA049692) |