Anti FGB pAb (ATL-HPA001901 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001901-100
  • Immunohistochemical staining of human cerebral cortex, liver, placenta and rectum using Anti-FGB antibody HPA001901 (A) shows similar protein distribution across tissues to independent antibody HPA001900 (B).
  • Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
  • Western blot analysis using Anti-FGB antibody HPA001901 (A) shows similar pattern to independent antibody HPA001900 (B).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: fibrinogen beta chain
Gene Name: FGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033831: 92%, ENSRNOG00000007092: 91%
Entrez Gene ID: 2244
Uniprot ID: P02675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQC
Gene Sequence VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQC
Gene ID - Mouse ENSMUSG00000033831
Gene ID - Rat ENSRNOG00000007092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FGB pAb (ATL-HPA001901 w/enhanced validation)
Datasheet Anti FGB pAb (ATL-HPA001901 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGB pAb (ATL-HPA001901 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FGB pAb (ATL-HPA001901 w/enhanced validation)
Datasheet Anti FGB pAb (ATL-HPA001901 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGB pAb (ATL-HPA001901 w/enhanced validation)



Citations for Anti FGB pAb (ATL-HPA001901 w/enhanced validation) – 4 Found
Rydbirk, Rasmus; Østergaard, Ole; Folke, Jonas; Hempel, Casper; DellaValle, Brian; Andresen, Thomas L; Løkkegaard, Annemette; Hejl, Anne-Mette; Bode, Matthias; Blaabjerg, Morten; Møller, Mette; Danielsen, Erik H; Salvesen, Lisette; Starhof, Charlotte C; Bech, Sara; Winge, Kristian; Rungby, Jørgen; Pakkenberg, Bente; Brudek, Tomasz; Olsen, Jesper V; Aznar, Susana. Brain proteome profiling implicates the complement and coagulation cascade in multiple system atrophy brain pathology. Cellular And Molecular Life Sciences : Cmls. 2022;79(6):336.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed