Anti FERMT3 pAb (ATL-HPA065231)

Atlas Antibodies

SKU:
ATL-HPA065231-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fermitin family member 3
Gene Name: FERMT3
Alternative Gene Name: KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024965: 84%, ENSRNOG00000021161: 84%
Entrez Gene ID: 83706
Uniprot ID: Q86UX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Gene Sequence MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Gene ID - Mouse ENSMUSG00000024965
Gene ID - Rat ENSRNOG00000021161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FERMT3 pAb (ATL-HPA065231)
Datasheet Anti FERMT3 pAb (ATL-HPA065231) Datasheet (External Link)
Vendor Page Anti FERMT3 pAb (ATL-HPA065231) at Atlas Antibodies

Documents & Links for Anti FERMT3 pAb (ATL-HPA065231)
Datasheet Anti FERMT3 pAb (ATL-HPA065231) Datasheet (External Link)
Vendor Page Anti FERMT3 pAb (ATL-HPA065231)