Protein Description: fermitin family member 3
Gene Name: FERMT3
Alternative Gene Name: KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024965: 84%, ENSRNOG00000021161: 84%
Entrez Gene ID: 83706
Uniprot ID: Q86UX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FERMT3
Alternative Gene Name: KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024965: 84%, ENSRNOG00000021161: 84%
Entrez Gene ID: 83706
Uniprot ID: Q86UX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT |
Documents & Links for Anti FERMT3 pAb (ATL-HPA065231) | |
Datasheet | Anti FERMT3 pAb (ATL-HPA065231) Datasheet (External Link) |
Vendor Page | Anti FERMT3 pAb (ATL-HPA065231) at Atlas |
Documents & Links for Anti FERMT3 pAb (ATL-HPA065231) | |
Datasheet | Anti FERMT3 pAb (ATL-HPA065231) Datasheet (External Link) |
Vendor Page | Anti FERMT3 pAb (ATL-HPA065231) |