Anti FEM1C pAb (ATL-HPA060977)

Atlas Antibodies

SKU: ATL-HPA060977-25

• 

Protein Description: fem-1 homolog c (C. elegans)
Gene Name: FEM1C
Alternative Gene Name: EUROIMAGE686608, EUROIMAGE783647, FEM1A, KIAA1785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033319: 99%, ENSRNOG00000003578: 100%
Entrez Gene ID: 56929
Uniprot ID: Q96JP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHP
• Gene Sequence: SFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHP
• Gene ID - Mouse: ENSMUSG00000033319
• Gene ID - Rat: ENSRNOG00000003578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.