Anti FBXO6 pAb (ATL-HPA051175)

Atlas Antibodies

SKU:
ATL-HPA051175-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: F-box protein 6
Gene Name: FBXO6
Alternative Gene Name: FBG2, FBS2, FBX6, Fbx6b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021962: 32%, ENSRNOG00000023931: 33%
Entrez Gene ID: 26270
Uniprot ID: Q9NRD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQI
Gene Sequence RVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQI
Gene ID - Mouse ENSMUSG00000021962
Gene ID - Rat ENSRNOG00000023931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXO6 pAb (ATL-HPA051175)
Datasheet Anti FBXO6 pAb (ATL-HPA051175) Datasheet (External Link)
Vendor Page Anti FBXO6 pAb (ATL-HPA051175) at Atlas Antibodies

Documents & Links for Anti FBXO6 pAb (ATL-HPA051175)
Datasheet Anti FBXO6 pAb (ATL-HPA051175) Datasheet (External Link)
Vendor Page Anti FBXO6 pAb (ATL-HPA051175)