Anti FBXO34 pAb (ATL-HPA052592)

Atlas Antibodies

SKU:
ATL-HPA052592-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: F-box protein 34
Gene Name: FBXO34
Alternative Gene Name: Fbx34, FLJ20725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037536: 51%, ENSRNOG00000011704: 51%
Entrez Gene ID: 55030
Uniprot ID: Q9NWN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVE
Gene Sequence ADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVE
Gene ID - Mouse ENSMUSG00000037536
Gene ID - Rat ENSRNOG00000011704
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXO34 pAb (ATL-HPA052592)
Datasheet Anti FBXO34 pAb (ATL-HPA052592) Datasheet (External Link)
Vendor Page Anti FBXO34 pAb (ATL-HPA052592) at Atlas Antibodies

Documents & Links for Anti FBXO34 pAb (ATL-HPA052592)
Datasheet Anti FBXO34 pAb (ATL-HPA052592) Datasheet (External Link)
Vendor Page Anti FBXO34 pAb (ATL-HPA052592)