Anti FBXO33 pAb (ATL-HPA046657 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046657-100
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FBXO33 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404384).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: F-box protein 33
Gene Name: FBXO33
Alternative Gene Name: Fbx33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035329: 95%, ENSRNOG00000005285: 95%
Entrez Gene ID: 254170
Uniprot ID: Q7Z6M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAVELERFVNLHSLALDFCDFTAEMARVL
Gene Sequence NNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAVELERFVNLHSLALDFCDFTAEMARVL
Gene ID - Mouse ENSMUSG00000035329
Gene ID - Rat ENSRNOG00000005285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FBXO33 pAb (ATL-HPA046657 w/enhanced validation)
Datasheet Anti FBXO33 pAb (ATL-HPA046657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXO33 pAb (ATL-HPA046657 w/enhanced validation)