Protein Description: F-box protein 32
Gene Name: FBXO32
Alternative Gene Name: ATROGIN1, Fbx32, MAFbx
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022358: 92%, ENSRNOG00000006738: 85%
Entrez Gene ID: 114907
Uniprot ID: Q969P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXO32
Alternative Gene Name: ATROGIN1, Fbx32, MAFbx
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022358: 92%, ENSRNOG00000006738: 85%
Entrez Gene ID: 114907
Uniprot ID: Q969P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK |
Documents & Links for Anti FBXO32 pAb (ATL-HPA065209) | |
Datasheet | Anti FBXO32 pAb (ATL-HPA065209) Datasheet (External Link) |
Vendor Page | Anti FBXO32 pAb (ATL-HPA065209) at Atlas |
Documents & Links for Anti FBXO32 pAb (ATL-HPA065209) | |
Datasheet | Anti FBXO32 pAb (ATL-HPA065209) Datasheet (External Link) |
Vendor Page | Anti FBXO32 pAb (ATL-HPA065209) |