Anti FBXO32 pAb (ATL-HPA065209)

Atlas Antibodies

SKU:
ATL-HPA065209-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: F-box protein 32
Gene Name: FBXO32
Alternative Gene Name: ATROGIN1, Fbx32, MAFbx
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022358: 92%, ENSRNOG00000006738: 85%
Entrez Gene ID: 114907
Uniprot ID: Q969P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
Gene Sequence PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
Gene ID - Mouse ENSMUSG00000022358
Gene ID - Rat ENSRNOG00000006738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXO32 pAb (ATL-HPA065209)
Datasheet Anti FBXO32 pAb (ATL-HPA065209) Datasheet (External Link)
Vendor Page Anti FBXO32 pAb (ATL-HPA065209) at Atlas Antibodies

Documents & Links for Anti FBXO32 pAb (ATL-HPA065209)
Datasheet Anti FBXO32 pAb (ATL-HPA065209) Datasheet (External Link)
Vendor Page Anti FBXO32 pAb (ATL-HPA065209)