Protein Description: F-box protein 16
Gene Name: FBXO16
Alternative Gene Name: FBX16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034532: 99%, ENSRNOG00000014003: 99%
Entrez Gene ID: 157574
Uniprot ID: Q8IX29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXO16
Alternative Gene Name: FBX16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034532: 99%, ENSRNOG00000014003: 99%
Entrez Gene ID: 157574
Uniprot ID: Q8IX29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRV |
| Gene ID - Mouse | ENSMUSG00000034532 |
| Gene ID - Rat | ENSMUSG00000034532 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXO16 pAb (ATL-HPA076472) | |
| Datasheet | Anti FBXO16 pAb (ATL-HPA076472) Datasheet (External Link) |
| Vendor Page | Anti FBXO16 pAb (ATL-HPA076472) at Atlas |
| Documents & Links for Anti FBXO16 pAb (ATL-HPA076472) | |
| Datasheet | Anti FBXO16 pAb (ATL-HPA076472) Datasheet (External Link) |
| Vendor Page | Anti FBXO16 pAb (ATL-HPA076472) |