Anti FBXL7 pAb (ATL-HPA055464)

Atlas Antibodies

SKU: ATL-HPA055464-25

• 

Protein Description: F-box and leucine-rich repeat protein 7
Gene Name: FBXL7
Alternative Gene Name: FBL6, FBL7, KIAA0840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043556: 99%, ENSRNOG00000024433: 99%
Entrez Gene ID: 23194
Uniprot ID: Q9UJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC
• Gene Sequence: LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC
• Gene ID - Mouse: ENSMUSG00000043556
• Gene ID - Rat: ENSRNOG00000024433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.