Protein Description: F-box and leucine-rich repeat protein 7
Gene Name: FBXL7
Alternative Gene Name: FBL6, FBL7, KIAA0840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043556: 99%, ENSRNOG00000024433: 99%
Entrez Gene ID: 23194
Uniprot ID: Q9UJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXL7
Alternative Gene Name: FBL6, FBL7, KIAA0840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043556: 99%, ENSRNOG00000024433: 99%
Entrez Gene ID: 23194
Uniprot ID: Q9UJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC |
Documents & Links for Anti FBXL7 pAb (ATL-HPA055464) | |
Datasheet | Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link) |
Vendor Page | Anti FBXL7 pAb (ATL-HPA055464) at Atlas |
Documents & Links for Anti FBXL7 pAb (ATL-HPA055464) | |
Datasheet | Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link) |
Vendor Page | Anti FBXL7 pAb (ATL-HPA055464) |