Anti FBXL7 pAb (ATL-HPA055464)

Catalog No:
ATL-HPA055464-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: F-box and leucine-rich repeat protein 7
Gene Name: FBXL7
Alternative Gene Name: FBL6, FBL7, KIAA0840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043556: 99%, ENSRNOG00000024433: 99%
Entrez Gene ID: 23194
Uniprot ID: Q9UJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC

Documents & Links for Anti FBXL7 pAb (ATL-HPA055464)
Datasheet Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link)
Vendor Page Anti FBXL7 pAb (ATL-HPA055464) at Atlas

Documents & Links for Anti FBXL7 pAb (ATL-HPA055464)
Datasheet Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link)
Vendor Page Anti FBXL7 pAb (ATL-HPA055464)