Anti FBXL3 pAb (ATL-HPA053283)

Atlas Antibodies

SKU: ATL-HPA053283-25

• 

Protein Description: F-box and leucine-rich repeat protein 3
Gene Name: FBXL3
Alternative Gene Name: FBL3, FBL3A, FBXL3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022124: 100%, ENSRNOG00000059334: 100%
Entrez Gene ID: 26224
Uniprot ID: Q9UKT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS
• Gene Sequence: HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS
• Gene ID - Mouse: ENSMUSG00000022124
• Gene ID - Rat: ENSRNOG00000059334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.